DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30F and Cpr76Bd

DIOPT Version :9

Sequence 1:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:138 Identity:46/138 - (33%)
Similarity:63/138 - (45%) Gaps:36/138 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GVGAAAAIELPIY-----------HSPAAIVKPL----------LKTVEVEAPAHYD------FA 48
            |||....:....|           |:|.|....|          ||.|..:...|:|      |.
  Fly  1095 GVGGIGPLGAGFYRYAPSVPALSSHAPVAATAYLKSAPVTQHAVLKVVPEKHLEHFDAHPRYAFE 1159

  Fly    49 YSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVRRDPLGQKVIKA 113
            |:|:|.||||.|.|.|.|.||.|:|:|:||:.||.:|||.|.:|...||:|         :||.:
  Fly  1160 YAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHA---------EVINS 1215

  Fly   114 APIAKLLA 121
            ....|::|
  Fly  1216 RDQGKIVA 1223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:395303 27/57 (47%)
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.