DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30F and Cpr76Ba

DIOPT Version :10

Sequence 1:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster


Alignment Length:66 Identity:36/66 - (54%)
Similarity:46/66 - (69%) Gaps:3/66 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EAPAH---YDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVV 101
            |.|.|   |:|.|.|.|..|||||.|.|:|.||:|:|.||:.:|||..|.|:||:|:||||.|.|
  Fly    92 EEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQATV 156

  Fly   102 R 102
            :
  Fly   157 K 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:459790 29/51 (57%)
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:459790 29/51 (57%)

Return to query results.
Submit another query.