DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30F and Cpr64Aa

DIOPT Version :9

Sequence 1:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:187 Identity:79/187 - (42%)
Similarity:97/187 - (51%) Gaps:48/187 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ALVSLFILGVGAAAAIELPIYHSPAAIVK---PLLKTVEVEAPAHYD------FAYSVHDEHTGD 58
            |||::....|.....:.||.|.|..|:.|   ||:  .:|..|..||      |:|.|||..|||
  Fly    11 ALVAVSSAVVVPGPGLALPAYPSYPALAKVAAPLV--AKVAGPEPYDPNPQYTFSYDVHDGSTGD 73

  Fly    59 IKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVRRDPLGQKVIKAAPIAKLLAPA 123
            :|||.|:|.||.|||.|:|::|||..|.|:||:|..:||||||||:  |..|...||:||:||||
  Fly    74 VKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRRE--GAVVKAVAPVAKVLAPA 136

  Fly   124 PL----PL----------------------------AY--AAPKLLAPAKLPLGLYH 146
            ||    ||                            ||  |.|||..||..||| ||
  Fly   137 PLLHASPLVAKVPAYGPALAPAYPALAHGYGPALAPAYGPALPKLALPALSPLG-YH 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:395303 30/57 (53%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.