DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30F and resilin

DIOPT Version :9

Sequence 1:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_611157.1 Gene:resilin / 36880 FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster


Alignment Length:63 Identity:22/63 - (34%)
Similarity:33/63 - (52%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EAPAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVR 102
            :.||.|:|.|.|.|..:|.....:|.|.||...|||.::..||..:.|:|.:| ..|:...:|
  Fly   340 DEPAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVEYEAD-QQGYRPQIR 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:395303 18/51 (35%)
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:278791 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.