DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30F and resilin

DIOPT Version :10

Sequence 1:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_611157.1 Gene:resilin / 36880 FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster


Alignment Length:63 Identity:22/63 - (34%)
Similarity:33/63 - (52%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EAPAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVR 102
            :.||.|:|.|.|.|..:|.....:|.|.||...|||.::..||..:.|:|.:| ..|:...:|
  Fly   340 DEPAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVEYEAD-QQGYRPQIR 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:459790 18/51 (35%)
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:459790 18/51 (35%)

Return to query results.
Submit another query.