DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30F and Cpr51A

DIOPT Version :10

Sequence 1:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_610968.1 Gene:Cpr51A / 36613 FlyBaseID:FBgn0033942 Length:144 Species:Drosophila melanogaster


Alignment Length:89 Identity:30/89 - (33%)
Similarity:39/89 - (43%) Gaps:20/89 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AHYDFAYSVHDE-HTGDIKSQTESRKGDQVQGQYT------------LVDADGYLRTVDYTSDAH 94
            |.|.|..||.|: :.|.| |:.|.|:|..|:|.|:            :.|.|||....|...|..
  Fly    42 AQYSFNSSVDDKINDGQI-SRNEEREGGTVRGSYSYFDGFVKRRVEYIADKDGYRVLKDEIEDVG 105

  Fly    95 NG--FN----AVVRRDPLGQKVIK 112
            ||  ||    |.|....:|:..||
  Fly   106 NGPSFNPDGIANVEGSMIGKYSIK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:459790 22/66 (33%)
Cpr51ANP_610968.1 Chitin_bind_4 44..94 CDD:459790 16/50 (32%)

Return to query results.
Submit another query.