powered by:
Protein Alignment Cpr30F and Crys
DIOPT Version :9
Sequence 1: | NP_723504.1 |
Gene: | Cpr30F / 318997 |
FlyBaseID: | FBgn0051876 |
Length: | 146 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001285854.1 |
Gene: | Crys / 34604 |
FlyBaseID: | FBgn0005664 |
Length: | 477 |
Species: | Drosophila melanogaster |
Alignment Length: | 65 |
Identity: | 33/65 - (50%) |
Similarity: | 44/65 - (67%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 YDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVRRDPLGQK 109
|.|||.|.|..|||.|.|.|.|.||.|:|||:|::.||..|.|:||:|..:||||:|.:..|.::
Fly 77 YSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSKQRLDEQ 141
Fly 110 109
Fly 142 141
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45453267 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2C9WU |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.840 |
|
Return to query results.
Submit another query.