DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr30F and Cpr11B

DIOPT Version :10

Sequence 1:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster


Alignment Length:114 Identity:33/114 - (28%)
Similarity:50/114 - (43%) Gaps:20/114 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EAPAHYDFAY----SVHDEHTGDIK-SQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNA 99
            :|..:|:|.:    .:|.:.||:.: .......|  |||.|:....||...||:||:| .|||:|
  Fly    80 DANGNYNFGFDTGNGIHRDETGEFRGGWPHGSLG--VQGSYSYTGDDGKQYTVNYTAD-KNGFHA 141

  Fly   100 VVRRDPLGQKVIKAAPIAKL-----------LAPAPLPLAYAAPKLLAP 137
            .....|:...| .|||..:.           .|.:.:|.|..|.:.|.|
  Fly   142 EGAHLPVSPSV-PAAPAGRSSYGAGGSGYRGSASSHVPAAAPATRYLPP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:459790 18/56 (32%)
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:459790 18/56 (32%)

Return to query results.
Submit another query.