DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31875 and MIDEAS

DIOPT Version :9

Sequence 1:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001354639.1 Gene:MIDEAS / 91748 HGNCID:19853 Length:1099 Species:Homo sapiens


Alignment Length:180 Identity:35/180 - (19%)
Similarity:63/180 - (35%) Gaps:62/180 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PWKREQDLQQLQ-HRASILWSP--QLQDQDDK--AVREYLDYAAS-------------LYDIEEE 72
            |..|::.|.... |:|.::|.|  .|:...:|  .|.:.|..|.|             |:.:.|.
Human   734 PLMRDRALAAADPHKADLVWQPWEDLESSREKQRQVEDLLTAACSSIFPGAGTNQELALHCLHES 798

  Fly    73 QALFI-----------LRRHGYDLPLAHRRLEKTETARGCRYH-----RWKAEDLIRLTKAFEQY 121
            :...:           ||.|.:  |||             .||     :||..:.....|....|
Human   799 RGDILETLNKLLLKKPLRPHNH--PLA-------------TYHYTGSDQWKMAERKLFNKGIAIY 848

  Fly   122 GTDFAKVRKELPHFPLAE-LRLYFSFMSSA------------LETDDQQA 158
            ..||..|:|.:....:|: :..|:::....            ::|.|:::
Human   849 KKDFFLVQKLIQTKTVAQCVEFYYTYKKQVKIGRNGTLTFGDVDTSDEKS 898

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 11/41 (27%)
MIDEASNP_001354639.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..159
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..264
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 330..349
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..397
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 410..441
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..563
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 887..1045 2/12 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.