DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31875 and ZNF541

DIOPT Version :9

Sequence 1:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_011525670.1 Gene:ZNF541 / 84215 HGNCID:25294 Length:1351 Species:Homo sapiens


Alignment Length:140 Identity:29/140 - (20%)
Similarity:47/140 - (33%) Gaps:26/140 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QHRASILWSP----QLQDQDDKAVREYLDYAAS-------------LYDIEEEQ-----ALFILR 79
            :|.||::|.|    .:..:....|.|..:.|.|             |:.:.|.|     ||..|.
Human  1083 EHVASLVWKPWGDMMISSETQDRVTELCNVACSSVMPGGGTNLELALHCLHEAQGNVQVALETLL 1147

  Fly    80 RHGYDLPLAHRRLEKTETARGCRYHRWKAEDLIRLTKAFEQYGTDFAKVRKELPHFPLAELRLYF 144
            ..|...|..|...:...|....    |...:.....|||..:..||..:.|.:....:|:...|:
Human  1148 LRGPHKPRTHLLADYRYTGSDV----WTPIEKRLFKKAFYAHKKDFYLIHKMIQTKTVAQCVEYY 1208

  Fly   145 SFMSSALETD 154
            ......::.|
Human  1209 YIWKKMIKFD 1218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 7/29 (24%)
ZNF541XP_011525670.1 C2H2 Zn finger 142..162 CDD:275368
zf-C2H2 142..162 CDD:278523
COG5048 150..>324 CDD:227381
zf-H2C2_2 154..179 CDD:290200
C2H2 Zn finger 170..195 CDD:275368
C2H2 Zn finger 203..225 CDD:275368
ELM2 1060..1115 CDD:279754 8/31 (26%)
SANT 1170..1214 CDD:197842 9/43 (21%)
SANT 1170..1213 CDD:304392 9/42 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.