DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31875 and rcor3

DIOPT Version :9

Sequence 1:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_031757914.1 Gene:rcor3 / 779496 XenbaseID:XB-GENE-981586 Length:560 Species:Xenopus tropicalis


Alignment Length:144 Identity:37/144 - (25%)
Similarity:63/144 - (43%) Gaps:11/144 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ATLPDFVPPWKREQDLQQLQHRASILWSPQLQDQDDKAVREYLDYAASLYDIEEEQALFILRRHG 82
            |.:|:|.|...:..|...   ...::|||.....|.| :.||:..|...:....||||.:|..|.
 Frog    53 ARIPEFDPGATKYTDKDS---GGMLVWSPHHNIADLK-LDEYIAIAKEKHGYNVEQALGMLFWHK 113

  Fly    83 YDLPLAHRRLEKTETARGCRYHRWKAEDLIRLTKAFEQYGTDFAKVRKELPHFPLAEL-RLYFSF 146
            :::..:...|.......    ..|..||.:...:||..:|..|.::::.||...:|.| :.|:|:
 Frog   114 HNIEKSLADLPNFTPFP----DEWTVEDKVLFEQAFSFHGKSFHRIQQMLPDKSIASLVKYYYSW 174

  Fly   147 MSSALETD--DQQA 158
            ..:...|.  |:||
 Frog   175 KKTRSRTSLMDRQA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 12/44 (27%)
rcor3XP_031757914.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001182
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.