DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31875 and Mier2

DIOPT Version :9

Sequence 1:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_006514144.1 Gene:Mier2 / 70427 MGIID:1917677 Length:563 Species:Mus musculus


Alignment Length:194 Identity:45/194 - (23%)
Similarity:72/194 - (37%) Gaps:63/194 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKQAATLPDFVPPWKREQDLQQL----------QHRASILWSPQLQDQDDKAVREYLDYAASLYD 68
            :|:....|.|      :.||..|          ::...:||||.:  ..::.|.|:| |.|....
Mouse   206 KKEIMVGPQF------QADLNILHLNRHCDKIYENEDQLLWSPSV--LPEREVEEFL-YRAVKRR 261

  Fly    69 IEE---------------EQALFILRRHGYDLPLAHRRLE-KTETARG--CRYHRWKAEDLIRLT 115
            .:|               ||||:.|.:..:::..|.|||. ..:..|.  |   .|..|:.....
Mouse   262 WQEMAGPQIPEGEVVKDSEQALYELVKCNFNVEEALRRLRFNVKVIRDGLC---AWSEEECRNFE 323

  Fly   116 KAFEQYGTDF-----AKVRKE-----LPHFPL---AELRLYFS---------FMSSALETDDQQ 157
            ..|..:|.:|     .|||..     :.::.|   :|...||:         |:||. .||.:|
Mouse   324 HGFRVHGKNFHLIQANKVRTRSVGECVEYYYLWKKSERYDYFAQQTRLGRRKFVSSG-TTDTEQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 12/54 (22%)
Mier2XP_006514144.1 ELM2 209..259 CDD:366648 14/58 (24%)
SANT_MTA3_like 314..358 CDD:212559 9/43 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.