DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31875 and MIER1

DIOPT Version :9

Sequence 1:	NP_001188765.1	Gene:	CG31875 / 318996	FlyBaseID:	FBgn0051875	Length:	161	Species:	Drosophila melanogaster
Sequence 2:	NP_001337459.1	Gene:	MIER1 / 57708	HGNCID:	29657	Length:	602	Species:	Homo sapiens

Alignment Length:	140	Identity:	32/140 - (22%)
Similarity:	53/140 - (37%)	Gaps:	39/140 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly    22 DFVP--PWKRE-------------------QDLQQLQHRASILWSPQ----------LQDQ---- 51
            |::|  .||:|                   ::.:..::...:||.|:          |:|.
Human   261 DYIPSEDWKKEIMVGSMFQAEIPVGICRYKENEKVYENDDQLLWDPEYLPEDKVIIFLKDASRRT 325

  Fly    52 -DDKAVREYLDYAASLYDIEEEQALFILRRHGYDLPLAHRRLEKTETARGCRYHRWKAEDLIRLT 115
             |:|.| |.:...:.:.|  .||||:.|.:..:|...|.|||.....|.......|..|:.....
Human   326 GDEKGV-EAIPEGSHIKD--NEQALYELVKCNFDTEEALRRLRFNVKAAREELSVWTEEECRNFE 387

  Fly   116 KAFEQYGTDF 125
            :..:.||.||
Human   388 QGLKAYGKDF 397

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31875	NP_001188765.1	ELM2	18..63	CDD:279754	14/76 (18%)
MIER1	NP_001337459.1	ELM2	272..321	CDD:307553	4/48 (8%)
MIER1	NP_001337459.1	SANT_MTA3_like	378..422	CDD:212559	6/20 (30%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1194
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810