DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31875 and mideasa

DIOPT Version :9

Sequence 1:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_005160646.1 Gene:mideasa / 569908 ZFINID:ZDB-GENE-041001-151 Length:1016 Species:Danio rerio


Alignment Length:172 Identity:33/172 - (19%)
Similarity:64/172 - (37%) Gaps:45/172 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IHYWRKQAATLPDFVPPWKREQDLQQLQHRASILWSPQLQDQDDKAVREYLDYAAS--LY----- 67
            |:...|..|.:|:.:   .|...|:. ||:|:::|.|:.....:..|...::...|  :|     
Zfish   656 INIGSKYQAEIPELL---DRSSALKD-QHKATLVWQPESSASQETRVDNLMNLVCSSVMYGGGTN 716

  Fly    68 -------------DIEEEQALFILRR--HGYDLPLAHRRLEKTETARGCRYH-----RWKAEDLI 112
                         |:.|...:.:|:.  ..::..||:             ||     .|.|::..
Zfish   717 TELAMHCLHECKGDVMEALEMMMLKNPIFSWNHQLAN-------------YHYAGSDYWSADEKR 768

  Fly   113 RLTKAFEQYGTDFAKVRKELPHFPLAE-LRLYFSFMSSALET 153
            ...|....|..||..|:|.:....:|: :..|:::...|..|
Zfish   769 YFNKGISAYTKDFFMVQKLVRTKTVAQCVEFYYTYKKQARVT 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 10/44 (23%)
mideasaXP_005160646.1 ELM2 656..707 CDD:279754 12/54 (22%)
SANT 760..805 CDD:197842 10/44 (23%)
SANT 762..805 CDD:304392 10/42 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.