DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31875 and mier3a

DIOPT Version :9

Sequence 1:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001025320.2 Gene:mier3a / 560884 ZFINID:ZDB-GENE-050913-97 Length:531 Species:Danio rerio


Alignment Length:101 Identity:23/101 - (22%)
Similarity:39/101 - (38%) Gaps:15/101 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ILWSPQLQDQDDKAVREYL------------DYAASLYDIEEEQALFILRRHGYDLPLAHRRLEK 94
            :||.|.:  ..:..|:.:|            |...||.. :.||||:.|.:..|::|.|..|...
Zfish   201 LLWQPDM--LPESKVKSFLLDALSADGKMDRDGRCSLVK-DNEQALYELLKCNYNVPEALERYRS 262

  Fly    95 TETARGCRYHRWKAEDLIRLTKAFEQYGTDFAKVRK 130
            .:.:.......|..|:......|...|..:|..::|
Zfish   263 NDKSSKDEMLPWSEEECRNFEHALLLYEKNFHLIQK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 6/32 (19%)
mier3aNP_001025320.2 ELM2 172..222 CDD:279754 5/22 (23%)
SANT 273..319 CDD:197842 6/26 (23%)
SANT_MTA3_like 274..318 CDD:212559 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.