DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31875 and mideasb

DIOPT Version :9

Sequence 1:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_009291493.1 Gene:mideasb / 560411 ZFINID:ZDB-GENE-131121-13 Length:1095 Species:Danio rerio


Alignment Length:152 Identity:33/152 - (21%)
Similarity:60/152 - (39%) Gaps:33/152 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKQAATLPDFVPPWKREQDLQQLQHRASILWSP----QLQDQDDKAVREYLDYAAS--LY--DIE 70
            |:::|.|.|.              |:|.::|:|    :...|..:.|.:.:..|.|  |:  ...
Zfish   744 RERSAALHDL--------------HKAELVWAPLPDLEASAQQQQKVNDLMHLACSSALFGGGTN 794

  Fly    71 EEQALFILRRHGYDL--PLAHRRLEKTETARG---CRYH-----RWKAEDLIRLTKAFEQYGTDF 125
            :|.|:..|.....|:  .|.|..|:|...::.   ..||     .|..|:.....|....|..||
Zfish   795 QELAMHCLYECKGDIMGTLTHLLLKKNIFSKSHPLADYHYSGSDSWTPEERRLFNKGIATYKKDF 859

  Fly   126 AKVRKELPHFPLAE-LRLYFSF 146
            ..|:|.:....:|: :..|:::
Zfish   860 FMVQKLVSSKTVAQCVEFYYTY 881

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 9/48 (19%)
mideasbXP_009291493.1 ELM2 730..785 CDD:279754 11/54 (20%)
SANT 838..883 CDD:197842 10/44 (23%)
SANT 839..883 CDD:304392 10/43 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.