DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31875 and mier3

DIOPT Version :9

Sequence 1:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_012815836.1 Gene:mier3 / 493448 XenbaseID:XB-GENE-947088 Length:545 Species:Xenopus tropicalis


Alignment Length:139 Identity:34/139 - (24%)
Similarity:60/139 - (43%) Gaps:15/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VPPWKRE--QDLQQLQHRASILWSPQLQDQDDKAVREYL-DYAASLYDIE--------EEQALFI 77
            :||::.:  .|....:|...:||.|.:..::  .|:||| |.:.:..:.|        .||||..
 Frog   186 IPPFQGKCLPDCTDYEHEDHLLWRPDVLPEN--KVKEYLSDISRAANEKEAGGVLLRDNEQALHE 248

  Fly    78 LRRHGYDLPLAHRRLEKTETARGCRYHRWKAEDLIRLTKAFEQYGTDFAKVRK-ELPHFPLAE-L 140
            |.:..|::..|..|...:..|.......|..|:......|...:|.||..::| |:....:|| :
 Frog   249 LFKCQYNIKEALERYNSSRKAAQDETTLWTEEECSNFEHALMTHGKDFHLIQKNEVKSRTVAECV 313

  Fly   141 RLYFSFMSS 149
            ..|:.:..|
 Frog   314 AFYYMWKKS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 12/41 (29%)
mier3XP_012815836.1 ELM2 176..222 CDD:279754 9/37 (24%)
SANT 277..322 CDD:197842 11/44 (25%)
SANT_MTA3_like 277..321 CDD:212559 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.