powered by:
Protein Alignment CG31875 and Mier1
DIOPT Version :9
Sequence 1: | NP_001188765.1 |
Gene: | CG31875 / 318996 |
FlyBaseID: | FBgn0051875 |
Length: | 161 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017448862.1 |
Gene: | Mier1 / 313418 |
RGDID: | 1562337 |
Length: | 698 |
Species: | Rattus norvegicus |
Alignment Length: | 140 |
Identity: | 32/140 - (22%) |
Similarity: | 53/140 - (37%) |
Gaps: | 39/140 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 DFVP--PWKRE-------------------QDLQQLQHRASILWSPQ----------LQDQ---- 51
|::| .||:| ::.:..::...:||.|: |:|.
Rat 357 DYIPSEDWKKEIMVGSMFQAEIPVGVCRYKENEKVYENDDQLLWDPEYLPEDKVIVFLKDASRRT 421
Fly 52 -DDKAVREYLDYAASLYDIEEEQALFILRRHGYDLPLAHRRLEKTETARGCRYHRWKAEDLIRLT 115
|:|.| |.:...:.:.| .||||:.|.:..:|...|.|||.....|.......|..|:.....
Rat 422 GDEKGV-EAIPEGSHIKD--NEQALYELVKCSFDTEEALRRLRFNVKAAREELSVWTEEECRNFE 483
Fly 116 KAFEQYGTDF 125
:..:.||.||
Rat 484 QGLKAYGKDF 493
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG31875 | NP_001188765.1 |
ELM2 |
18..63 |
CDD:279754 |
14/76 (18%) |
Mier1 | XP_017448862.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1194 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.