DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31875 and Mier1

DIOPT Version :9

Sequence 1:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_017448862.1 Gene:Mier1 / 313418 RGDID:1562337 Length:698 Species:Rattus norvegicus


Alignment Length:140 Identity:32/140 - (22%)
Similarity:53/140 - (37%) Gaps:39/140 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DFVP--PWKRE-------------------QDLQQLQHRASILWSPQ----------LQDQ---- 51
            |::|  .||:|                   ::.:..::...:||.|:          |:|.    
  Rat   357 DYIPSEDWKKEIMVGSMFQAEIPVGVCRYKENEKVYENDDQLLWDPEYLPEDKVIVFLKDASRRT 421

  Fly    52 -DDKAVREYLDYAASLYDIEEEQALFILRRHGYDLPLAHRRLEKTETARGCRYHRWKAEDLIRLT 115
             |:|.| |.:...:.:.|  .||||:.|.:..:|...|.|||.....|.......|..|:.....
  Rat   422 GDEKGV-EAIPEGSHIKD--NEQALYELVKCSFDTEEALRRLRFNVKAAREELSVWTEEECRNFE 483

  Fly   116 KAFEQYGTDF 125
            :..:.||.||
  Rat   484 QGLKAYGKDF 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 14/76 (18%)
Mier1XP_017448862.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.