DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31875 and Zfp541

DIOPT Version :9

Sequence 1:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001100928.2 Gene:Zfp541 / 308108 RGDID:1310756 Length:1301 Species:Rattus norvegicus


Alignment Length:160 Identity:32/160 - (20%)
Similarity:55/160 - (34%) Gaps:43/160 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EQDLQQLQHR---------ASILW--------SPQLQDQDDKAVREYLDYAAS------------ 65
            :.::.:||.|         ||::|        :|:.||:    |.|..:.|.|            
  Rat  1010 QAEIPELQERPLTRVDENVASLVWKPWGDVMTNPETQDR----VMELCNVACSSVMPGGGTNLEL 1070

  Fly    66 ----LYDIE--EEQALFILRRHGYDLPLAHRRLEKTETARGCRYHRWKAEDLIRLTKAFEQYGTD 124
                |:|.:  .:.||..|...|...|..|...:...|....    |...:.....|||..:..|
  Rat  1071 ALHCLHDAQGSVQVALETLLLRGPQKPRTHPLADYRYTGSDI----WTPMEKRLFKKAFCAHKKD 1131

  Fly   125 FAKVRKELPHFPLAELRLYFSFMSSALETD 154
            |..:.|.:....:|:...|:......::.|
  Rat  1132 FYLIHKTIQTKSVAQCVEYYYIWKKMVKFD 1161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 11/49 (22%)
Zfp541NP_001100928.2 COG5236 <80..>227 CDD:227561
C2H2 Zn finger 142..162 CDD:275368
zf-C2H2 168..190 CDD:395048
C2H2 Zn finger 170..190 CDD:275368
C2H2 Zn finger 198..216 CDD:275368
PHA03247 <244..672 CDD:223021
ELM2 1003..1058 CDD:396160 12/51 (24%)
SANT 1113..1156 CDD:419695 9/42 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.