DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31875 and RCOR1

DIOPT Version :9

Sequence 1:	NP_001188765.1	Gene:	CG31875 / 318996	FlyBaseID:	FBgn0051875	Length:	161	Species:	Drosophila melanogaster
Sequence 2:	NP_055971.2	Gene:	RCOR1 / 23186	HGNCID:	17441	Length:	485	Species:	Homo sapiens

Alignment Length:	144	Identity:	37/144 - (25%)
Similarity:	67/144 - (46%)	Gaps:	9/144 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    18 ATLPDFVPPWKREQDLQQLQHRASILWSPQLQDQDDKAVREYLDYAASLYDIEEEQALFILRRHG 82
            |.:||| .|.|..:..|:..:...::|||. |:..:..:.||:..|...:....||||.:|..|.
Human   113 AVVPDF-DPAKLARRSQERDNLGMLVWSPN-QNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHK 175

  Fly    83 YDLPLAHRRLEKTETARGCRYHRWKAEDLIRLTKAFEQYGTDFAKVRKELPHFPLAEL-RLYFSF 146
            :::..:...|.......    ..|..||.:...:||..:|..|.::::.||...:|.| :.|:|:
Human   176 HNIEKSLADLPNFTPFP----DEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSW 236

  Fly   147 MSSALETD--DQQA 158
            ..:..:|.  |:.|
Human   237 KKTRTKTSVMDRHA 250

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31875	NP_001188765.1	ELM2	18..63	CDD:279754	13/44 (30%)
RCOR1	NP_055971.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..26
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	49..110
		Interaction with HDAC1. /evidence=ECO:0000269\|PubMed:11516394	78..257		37/144 (26%)
		ELM2	105..158	CDD:307553	14/46 (30%)
		SANT	194..238	CDD:328756	13/43 (30%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	244..314		2/7 (29%)
		Interaction with KDM1A. /evidence=ECO:0000269\|PubMed:16885027	296..384
		Myb_DNA-binding	385..428	CDD:306708
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	442..485
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1194
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S5681
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0001182
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	4	3.760