DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31875 and Ddx46

DIOPT Version :9

Sequence 1:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001268984.1 Gene:Ddx46 / 212880 MGIID:1920895 Length:1032 Species:Mus musculus


Alignment Length:110 Identity:25/110 - (22%)
Similarity:41/110 - (37%) Gaps:43/110 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QDQDDKAVREYLDYAASLYD---IEEEQALFILRRHGYDLPLAHRRLEKTETARGCRYHRWKAED 110
            :|:|||...:..|  |..:|   :|||.               .:|.|:.|        :|:.| 
Mouse   135 KDKDDKEDEKEKD--AGNFDQNKLEEEM---------------RKRKERVE--------KWREE- 173

  Fly   111 LIRLTKAFEQYGTDFAKVRKELPHFPLAELRLYFSFMSSALETDD 155
              :..||.|..|    :::||:......:        ..:||.||
Mouse   174 --QRKKAMENIG----ELKKEIEEMKQGK--------KWSLEDDD 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 5/13 (38%)
Ddx46NP_001268984.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..227 25/110 (23%)
SrmB 344..826 CDD:223587
Q motif 372..400
DEADc 378..581 CDD:238167
DEAD box 529..532
Helicase_C 618..714 CDD:278689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0334
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.