DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31875 and saeg-1

DIOPT Version :9

Sequence 1:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_505769.2 Gene:saeg-1 / 179505 WormBaseID:WBGene00010012 Length:900 Species:Caenorhabditis elegans


Alignment Length:157 Identity:34/157 - (21%)
Similarity:64/157 - (40%) Gaps:23/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VPPWKREQ----DLQQLQHRASILWSPQ-LQDQDDKAVREY----LDYAASLYDIEEEQALFILR 79
            |..|...|    :...::.|..|::|.: |||.|.:.:..:    ...|.......:|.||.:|.
 Worm   463 VKKWCDRQVSTSERDAIEDRDEIVFSSEILQDIDPEQITAFELLACSQACPRAGRNKELALHLLM 527

  Fly    80 RHGYDLPLAHRRLEKTET--------ARGCRYH---RWKAEDLIRLTKAFEQYGTDFAKVRKELP 133
            .:..::..|...|.:::|        ..|..|:   .|..:::.:...|..|...||.||..|||
 Worm   528 ENKGNIEAAVEDLLRSDTLDWEHYSSVFGYMYNDSVLWTPDEIYQFQDAIYQSEKDFDKVAVELP 592

  Fly   134 HFPLAE-LRLYFSFMSSALETDDQQAI 159
            ...:.| ::.|:::....  .||.:.:
 Worm   593 GKSVKECVQFYYTWKKDC--PDDYRKL 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 10/47 (21%)
saeg-1NP_505769.2 SANT 565..608 CDD:304392 12/42 (29%)
SANT 565..608 CDD:197842 12/42 (29%)
zf-C2H2 736..758 CDD:278523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.