DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31875 and rcor-1

DIOPT Version :9

Sequence 1:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_490662.1 Gene:rcor-1 / 171592 WormBaseID:WBGene00022278 Length:564 Species:Caenorhabditis elegans


Alignment Length:116 Identity:27/116 - (23%)
Similarity:51/116 - (43%) Gaps:9/116 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QDLQQLQHRASILWS-PQLQDQDDKAVREYLDYAASLYDIEEEQALFILRRHGYDLPLAHRRLEK 94
            :.|::...|...:|: |  .:.::..:.||:..|...|.:..::|||||.:...|...|     .
 Worm   126 EQLEKEPCRDQQIWAFP--DEMNENRLTEYISEATGRYQLPIDRALFILNKQSNDFDAA-----M 183

  Fly    95 TETARGCRYH-RWKAEDLIRLTKAFEQYGTDFAKVRKELPHFPLAELRLYF 144
            .:..|....| .|.||::...:..|..:|..|.|:...:|...|:.:..|:
 Worm   184 VQAMRRKEIHDDWTAEEISLFSTCFFHFGKRFKKIHAAMPQRSLSSIIQYY 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 6/32 (19%)
rcor-1NP_490662.1 Myb_DNA-binding 196..238 CDD:365977 10/39 (26%)
GATA 275..308 CDD:366024
Myb_DNA-binding 502..541 CDD:365977
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001182
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.