DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31875 and Rcor2

DIOPT Version :9

Sequence 1:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_006526614.1 Gene:Rcor2 / 104383 MGIID:1859854 Length:532 Species:Mus musculus


Alignment Length:147 Identity:37/147 - (25%)
Similarity:67/147 - (45%) Gaps:16/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ATLPDFVPPWKREQDLQQLQHRASILWSPQLQDQDDKAVREYLDYAASLYDIEEEQALFILRRHG 82
            |.:|:..|........::|  :..::|||.....|.| :.:|:..|...:....||||.:|..|.
Mouse    63 AVIPECKPESPARYSNKEL--KGMLVWSPNHCVSDAK-LDKYIAMAKEKHGYNIEQALGMLLWHK 124

  Fly    83 YDLPLAHRRLEKT--ETARGCRY-HRWKAEDLIRLTKAFEQYGTDFAKVRKELPHFPLAEL-RLY 143
            :|       :||:  :.|....: ..|..||.:...:||..:|..|.::::.||...:..| :.|
Mouse   125 HD-------VEKSLADLANFTPFPDEWTVEDKVLFEQAFGFHGKCFQRIQQMLPDKVIPSLVKYY 182

  Fly   144 FSFMSSALETD--DQQA 158
            :|:..:...|.  |:||
Mouse   183 YSWKKTRSRTSVMDRQA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 10/44 (23%)
Rcor2XP_006526614.1 ELM2 55..107 CDD:366648 11/46 (24%)
SANT 143..187 CDD:389774 12/43 (28%)
Myb_DNA-binding 340..383 CDD:365977
PRK12323 <399..>531 CDD:237057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001182
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.