DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31875 and Rcor1

DIOPT Version :9

Sequence 1:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_017449463.2 Gene:Rcor1 / 102554884 RGDID:7505493 Length:481 Species:Rattus norvegicus


Alignment Length:155 Identity:39/155 - (25%)
Similarity:66/155 - (42%) Gaps:31/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ATLPDFVPPWKREQDLQQLQHRASILWSPQLQDQDDKAVREYLDYAASLYDIEEEQALFILRRHG 82
            |.:||| .|.|..:..|:..:...::|||. |...:..:.||:..|...:....||||.:|..|.
  Rat   108 AAVPDF-DPAKLARRSQERDNLGMLVWSPN-QSLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHK 170

  Fly    83 Y-------DLPLAHRRLEKTETARGCRY----HRWKAEDLIRLTKAFEQYGTDFAKVRKELPHFP 136
            :       |||               .:    ..|..||.:...:||..:|..|.::::.||...
  Rat   171 HNIEKSLADLP---------------NFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKS 220

  Fly   137 LAEL-RLYFSFMSSALETD--DQQA 158
            :|.| :.|:|:..:..:|.  |:.|
  Rat   221 IASLVKFYYSWKKTRTKTSVMDRHA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 13/44 (30%)
Rcor1XP_017449463.2 ELM2 100..153 CDD:396160 14/46 (30%)
SANT 189..233 CDD:419695 13/43 (30%)
Myb_DNA-binding 380..423 CDD:395191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001182
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.