DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada1-2 and AT4G33890

DIOPT Version :9

Sequence 1:NP_723703.1 Gene:Ada1-2 / 318992 FlyBaseID:FBgn0051866 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_195115.1 Gene:AT4G33890 / 829532 AraportID:AT4G33890 Length:342 Species:Arabidopsis thaliana


Alignment Length:296 Identity:59/296 - (19%)
Similarity:99/296 - (33%) Gaps:97/296 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ERYRANMKNWFRSRWTKEEFDAESRKILTPDKLHLHNQFLLALLNKIDAFAPLENPPAVQTSSS- 85
            |.|...:..:|..:.||.|||....|.:....:||||:.:.:::...   ...::||.::...| 
plant    29 ESYFNQLGRFFALKITKSEFDKLCIKTIGRQNIHLHNRLIRSIIKNA---CIAKSPPFIKKGGSF 90

  Fly    86 ----SGNRSKR----------------RKRSSRTFAERLNFELSDVLDFVAEDNMQIIRPPTTIG 130
                :|:..|.                ||..||...:|             ...:..:..|.::.
plant    91 VRFGNGDSKKNSQIQPLHGDSAFSPSTRKCRSRKLRDR-------------PSPLGPLGKPHSLT 142

  Fly   131 IPSDQQQQQLQSQRYCAQELFLPDAGFIMGRFLIGAW-EIGLVSVDD-NVAEYVAMAVQVLLKDL 193
            ..:::...:.||    |.||           ..:|:. .:.:|||:: ...|.:|..        
plant   143 TTNEESMSKAQS----ATEL-----------LSLGSRPPVEVVSVEEGEEVEQIAGG-------- 184

  Fly   194 LSAIIKKRKHYKTSGEGNFYYDVGAPLRDP-----SLRNTVTRQKVDDTPLELDKELNTANFMRR 253
             |..::.|                .||..|     ||||..||:.|.:.      .:.:.:|.|.
plant   185 -SPSVQSR----------------CPLTAPLGVSMSLRNGATRKSVSNV------SMCSRSFNRE 226

  Fly   254 --QN-----DDVTFLSACEEVQPTERTVITLKDCQL 282
              ||     |..|..|..|.....|...||:....|
plant   227 TCQNNGELPDTRTLRSRLERRLEMEGLKITMDSVSL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ada1-2NP_723703.1 SAGA-Tad1 10..>74 CDD:289533 13/51 (25%)
AT4G33890NP_195115.1 SAGA-Tad1 9..282 CDD:403847 59/296 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21277
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.