DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada1-2 and AT4G31440

DIOPT Version :10

Sequence 1:NP_723703.1 Gene:Ada1-2 / 318992 FlyBaseID:FBgn0051866 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_194872.1 Gene:AT4G31440 / 829271 AraportID:AT4G31440 Length:379 Species:Arabidopsis thaliana


Alignment Length:65 Identity:18/65 - (27%)
Similarity:31/65 - (47%) Gaps:3/65 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RYRANMKNWFRSRWTKEEFDAESRKILTPDKLHLHNQFLLALLNKIDAFAPLENPPAVQTSSSSG 87
            ||...:..:...:.||.|||....::|..:.|.|||:.:.::|.....   .::||:|..|...|
plant    29 RYFYYLGRFLSQKLTKSEFDKSCFRLLGRENLSLHNKLIRSILRNASL---AKSPPSVHQSGHPG 90

  Fly    88  87
            plant    91  90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ada1-2NP_723703.1 SAGA-Tad1 10..>82 CDD:463692 16/58 (28%)
HFD_TADA1 152..236 CDD:467058
AT4G31440NP_194872.1 SAGA-Tad1 8..290 CDD:463692 18/65 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.