DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada1-2 and AT2G24530

DIOPT Version :9

Sequence 1:NP_723703.1 Gene:Ada1-2 / 318992 FlyBaseID:FBgn0051866 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001324326.1 Gene:AT2G24530 / 816989 AraportID:AT2G24530 Length:407 Species:Arabidopsis thaliana


Alignment Length:306 Identity:67/306 - (21%)
Similarity:104/306 - (33%) Gaps:90/306 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KEALVVALG-DNWERYRANMKNWFRSRWTKEEFDAESRKILTPDKLHLHNQFLLALL-NKIDAFA 72
            ||.:|...| :...||...:..:...:.||.|||....::|..:.|.||||.:.::| |...|.:
plant    15 KEHIVKKTGVERSRRYFYYLGRFLSQKLTKSEFDKTCLRLLGRENLSLHNQLIRSILRNATVAKS 79

  Fly    73 PLENPPAVQTSSS---------------SGN------------------------RSKRRKRSSR 98
            |   ||..:...|               ||.                        ||..:.|.||
plant    80 P---PPDHEAGHSTKANAFQSRGDGLEQSGTLIPNHSQHEPVWSNGVLPISPRKVRSGMQNRKSR 141

  Fly    99 TFAERL--NFELSDVL--DFVAEDNMQIIRPPTTIGIPSDQQQQQLQSQRYCAQELFLPDAGFIM 159
            .....|  |.::..:|  ....|||.      .::|:.:...|   :|.||.|.|   .|     
plant   142 DRPSPLGSNGKVEHMLHQPVCREDNR------GSVGMENGDYQ---RSGRYVADE---KD----- 189

  Fly   160 GRFL--------IGAWEIGLVSVDDNVAEYVAMAVQVLLKDLLSAI-----------IKKRKHYK 205
            |.||        ....:|..||:.|:..:.....|.:.:..|::.:           ..:.....
plant   190 GEFLRPVEKPRIPNKEKIAAVSMRDDQNQEEQARVNLSMSPLIAPLGIPFCSASVGGSPRTIPVS 254

  Fly   206 TSGEGNFYYDVGAPLRD-----PSLRNTVTRQKVDDTPLELDKELN 246
            |:.|....||.|. |.|     ..:.|....|.::...:|..|.||
plant   255 TNAELISCYDSGG-LPDIEMLRKRMENIAVAQGLEGVSMECAKTLN 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ada1-2NP_723703.1 SAGA-Tad1 10..>74 CDD:289533 20/65 (31%)
AT2G24530NP_001324326.1 SAGA-Tad1 8..317 CDD:403847 67/306 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21277
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.