DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada1-1 and AT5G67410

DIOPT Version :9

Sequence 1:NP_001285858.1 Gene:Ada1-1 / 318991 FlyBaseID:FBgn0051865 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001318896.1 Gene:AT5G67410 / 836877 AraportID:AT5G67410 Length:287 Species:Arabidopsis thaliana


Alignment Length:298 Identity:61/298 - (20%)
Similarity:100/298 - (33%) Gaps:98/298 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ERYRANMKNWFRSRWTKEEFDAESRKILTPDKLHLHNQFLLALLNKIDAFAPLENPPAVQTSSSS 86
            |.|...:..:...:.:|.:||......:..:.:.|||..|..:|..|.....|  ||.|:....|
plant    30 ESYLNLLSKFLSLKISKSDFDKLIIVTVKRENISLHNALLRGILKNICLSKTL--PPFVKNGVES 92

  Fly    87 GNRSK---------------RRKRSCRTFAERLNFE--LSDVLDFVAEDNMQIIRPPTTIGIPSD 134
            .|:.|               |..|..|| ..|||.:  :|.....|.|           :...|.
plant    93 DNKKKKQLNGAFQSLCKELPRSPRKGRT-QRRLNKDGNISKGKSLVTE-----------VVSSSG 145

  Fly   135 QQQQQLQSQRYCAQELFLPDAGFIMGRFLIGAWEIGLVSVDDNVAEYVAMAVQVLLKDLLSAIIK 199
            :||..:::.....|              ||..|.          ::.:.....|.|:|    :||
plant   146 RQQWSMENVEEVDQ--------------LIPCWR----------SQPIEAPFGVNLRD----VIK 182

  Fly   200 KRKHYKT----SGEGNFYYDVGAPLRDPSLRNTVTRQK--VDDTPLELDKELNTAN--------F 250
            |:....|    |||               |.::|:.:|  .||....|:..:..||        |
plant   183 KQHRIDTCCYSSGE---------------LPDSVSLKKKLEDDLEEGLEVSVGFANSLNAGLDVF 232

  Fly   251 MRRQNDDVTFLSACEEVQPTE----RTVITLKDCQLAL 284
            ::|      .:..|.|:..:.    .:..:|.|.|:|:
plant   233 LKR------LIKPCLELAASRSSNASSASSLVDFQVAM 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ada1-1NP_001285858.1 SAGA-Tad1 10..>74 CDD:289533 11/51 (22%)
AT5G67410NP_001318896.1 SAGA-Tad1 10..243 CDD:403847 56/275 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21277
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.