DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada1-1 and AT2G14850

DIOPT Version :9

Sequence 1:NP_001285858.1 Gene:Ada1-1 / 318991 FlyBaseID:FBgn0051865 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_179091.1 Gene:AT2G14850 / 815974 AraportID:AT2G14850 Length:291 Species:Arabidopsis thaliana


Alignment Length:304 Identity:58/304 - (19%)
Similarity:111/304 - (36%) Gaps:89/304 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ERYRANMKNWFRSRWTKEEFDAESRKILTPDKLHLHNQFLLALL-NKIDAFAPLENPPAVQTSSS 85
            :.|...:..:..||.:|.|||....|.:..:.:.|||:.:.::| |...|.:|   ||.....|.
plant    29 DTYFDQLGKFLTSRISKSEFDKLCSKTVGRENISLHNRLVRSILKNASVAKSP---PPRYPKKSL 90

  Fly    86 SGN----RSKRRKRSCRTFAERLNFELSDVLDFVAEDNMQIIRPPTTIG-------IPSDQQQQQ 139
            .|:    .|.|:.|| |.|.:|                      |:.:|       :.:...:..
plant    91 YGDPVFPPSPRKCRS-RKFRDR----------------------PSPLGPLGKPQSLTTTNDESM 132

  Fly   140 LQSQRYCAQELFLPDAGFIMGRFLIGAWEIGLVSVDD-NVAEYVAMAVQVLLKDLLSAIIKKRKH 203
            .::||       ||               :.:|||:| ...|.:..:..|..:..|:|.:....|
plant   133 SKAQR-------LP---------------MEVVSVEDGEEVEQMTGSPSVQSRSPLTAPLGVSFH 175

  Fly   204 YKTSGEGNFYYDVGAPLRDPS--LRNTVTRQKVDDTPLELD---KELNTAN--------FMRRQN 255
            .|:....:.|..:.......|  |.:.:|.:...:..||::   ..:::||        :|||  
plant   176 LKSKARFSTYNGINRETCQSSGELPDMITLRARLEKKLEMEGIKLSMDSANLLNRGLNAYMRR-- 238

  Fly   256 DDVTFLSACEEVQPTERTVITLKDCQLALRDRNLIGSHAVYSIN 299
                .:..|..:...::.         |:.:.:::..||...:|
plant   239 ----LIEPCLSLASQQKR---------AVSNVSMLDFHAAMEVN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ada1-1NP_001285858.1 SAGA-Tad1 10..>74 CDD:289533 14/52 (27%)
AT2G14850NP_179091.1 SAGA-Tad1 7..247 CDD:289533 54/271 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21277
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.