DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Qtzl and NFS1

DIOPT Version :9

Sequence 1:NP_001260401.1 Gene:Qtzl / 318990 FlyBaseID:FBgn0051864 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_066923.3 Gene:NFS1 / 9054 HGNCID:15910 Length:457 Species:Homo sapiens


Alignment Length:75 Identity:33/75 - (44%)
Similarity:44/75 - (58%) Gaps:11/75 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ATSSRTAAKPAATSKEFR----ERQVRFNIKNEQTEG-------RPLYLDAQATTPMDPRVLDAM 82
            |.::....||||.::..|    :|..:..:..:....       ||||:|.|||||:||||||||
Human    13 AVTAAPGPKPAAPTRGLRLRVGDRAPQSAVPADTAAAPEVGPVLRPLYMDVQATTPLDPRVLDAM 77

  Fly    83 LPYLTNFYGN 92
            ||||.|:|||
Human    78 LPYLINYYGN 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
QtzlNP_001260401.1 AAT_I 64..>92 CDD:302748 22/27 (81%)
NFS1NP_066923.3 PRK14012 58..457 CDD:184450 25/30 (83%)
Aminotran_5 60..421 CDD:278684 23/28 (82%)
Pyridoxal phosphate binding. /evidence=ECO:0000250|UniProtKB:P0A6B9 127..128
Pyridoxal phosphate binding. /evidence=ECO:0000250|UniProtKB:P0A6B9 255..257
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D287160at33208
OrthoFinder 1 1.000 - - FOG0003620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.