DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Qtzl and Nfs1

DIOPT Version :9

Sequence 1:NP_001260401.1 Gene:Qtzl / 318990 FlyBaseID:FBgn0051864 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_445914.2 Gene:Nfs1 / 84594 RGDID:620912 Length:459 Species:Rattus norvegicus


Alignment Length:72 Identity:34/72 - (47%)
Similarity:40/72 - (55%) Gaps:15/72 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 AKPAATSKEFRE-----RQVRFNIKNEQTEG----------RPLYLDAQATTPMDPRVLDAMLPY 85
            |..||||...|.     |.:|..:.:.....          ||||:|.|||||:|||||||||||
  Rat    18 ASLAATSVALRRSSVPTRGLRLRVVDHAPHSAVPSEAEAVLRPLYMDVQATTPLDPRVLDAMLPY 82

  Fly    86 LTNFYGN 92
            |.|:|||
  Rat    83 LVNYYGN 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
QtzlNP_001260401.1 AAT_I 64..>92 CDD:302748 22/27 (81%)
Nfs1NP_445914.2 PRK14012 60..459 CDD:184450 25/30 (83%)
Aminotran_5 62..423 CDD:278684 23/28 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D287160at33208
OrthoFinder 1 1.000 - - FOG0003620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.