powered by:
Protein Alignment Qtzl and Nfs1
DIOPT Version :9
Sequence 1: | NP_001260401.1 |
Gene: | Qtzl / 318990 |
FlyBaseID: | FBgn0051864 |
Length: | 123 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_445914.2 |
Gene: | Nfs1 / 84594 |
RGDID: | 620912 |
Length: | 459 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 34/72 - (47%) |
Similarity: | 40/72 - (55%) |
Gaps: | 15/72 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 AKPAATSKEFRE-----RQVRFNIKNEQTEG----------RPLYLDAQATTPMDPRVLDAMLPY 85
|..||||...|. |.:|..:.:..... ||||:|.|||||:|||||||||||
Rat 18 ASLAATSVALRRSSVPTRGLRLRVVDHAPHSAVPSEAEAVLRPLYMDVQATTPLDPRVLDAMLPY 82
Fly 86 LTNFYGN 92
|.|:|||
Rat 83 LVNYYGN 89
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D287160at33208 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003620 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.