powered by:
Protein Alignment Qtzl and SCLY
DIOPT Version :9
Sequence 1: | NP_001260401.1 |
Gene: | Qtzl / 318990 |
FlyBaseID: | FBgn0051864 |
Length: | 123 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_057594.5 |
Gene: | SCLY / 51540 |
HGNCID: | 18161 |
Length: | 445 |
Species: | Homo sapiens |
Alignment Length: | 73 |
Identity: | 22/73 - (30%) |
Similarity: | 31/73 - (42%) |
Gaps: | 8/73 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 RTAAKPAATSKEFRERQVRFNIKNEQTEGRPLYLDAQATTPMDPRVLDAMLPYLTNFYGNLVRTL 97
|.|..|||:... ......:..|.:|:|..||||::|.|:.||...:...:||.....
Human 9 RDAPAPAASQPS--------GCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGNPSSPY 65
Fly 98 RLQRLAKD 105
...|.|||
Human 66 SAGRKAKD 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D287160at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.