DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Qtzl and SCLY

DIOPT Version :9

Sequence 1:NP_001260401.1 Gene:Qtzl / 318990 FlyBaseID:FBgn0051864 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_057594.5 Gene:SCLY / 51540 HGNCID:18161 Length:445 Species:Homo sapiens


Alignment Length:73 Identity:22/73 - (30%)
Similarity:31/73 - (42%) Gaps:8/73 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RTAAKPAATSKEFRERQVRFNIKNEQTEGRPLYLDAQATTPMDPRVLDAMLPYLTNFYGNLVRTL 97
            |.|..|||:...        ......:..|.:|:|..||||::|.|:.||...:...:||.....
Human     9 RDAPAPAASQPS--------GCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGNPSSPY 65

  Fly    98 RLQRLAKD 105
            ...|.|||
Human    66 SAGRKAKD 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
QtzlNP_001260401.1 AAT_I 64..>92 CDD:302748 10/27 (37%)
SCLYNP_057594.5 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 5/26 (19%)
NifS 30..441 CDD:224029 17/44 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D287160at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.