DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Qtzl and scly

DIOPT Version :9

Sequence 1:NP_001260401.1 Gene:Qtzl / 318990 FlyBaseID:FBgn0051864 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_012825812.1 Gene:scly / 496582 XenbaseID:XB-GENE-485701 Length:448 Species:Xenopus tropicalis


Alignment Length:123 Identity:31/123 - (25%)
Similarity:49/123 - (39%) Gaps:32/123 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLGRIQAQVLRS--RATNALANVVRHEATSSRTAAKP--------AATSKEFRERQVRFNIKNEQ 58
            |.|||:.:.:.|  |....|.:::.  |.:......|        |:.|||            ..
 Frog   168 VTGRIEVEDIISAVRPNTCLVSIML--ANNETGVIMPVGELSQCLASMSKE------------RS 218

  Fly    59 TEGRP---LYLD-AQATTPMDPRVLDAMLPYLT----NFYGNLVRTLRLQRLAKDSGL 108
            .:|.|   |:.| |||...::..|.:..:.|||    .|||..:..|.::.|.:.|.|
 Frog   219 AQGLPKILLHTDAAQALGKVEVDVQELGVNYLTIVGHKFYGPRIGALYVRGLGQHSSL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
QtzlNP_001260401.1 AAT_I 64..>92 CDD:302748 11/32 (34%)
sclyXP_012825812.1 NifS 32..437 CDD:224029 31/123 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D287160at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.