DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Qtzl and Nfs1

DIOPT Version :9

Sequence 1:NP_001260401.1 Gene:Qtzl / 318990 FlyBaseID:FBgn0051864 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_609533.1 Gene:Nfs1 / 34613 FlyBaseID:FBgn0032393 Length:462 Species:Drosophila melanogaster


Alignment Length:92 Identity:92/92 - (100%)
Similarity:92/92 - (100%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKVLGRIQAQVLRSRATNALANVVRHEATSSRTAAKPAATSKEFRERQVRFNIKNEQTEGRPLY 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MQKVLGRIQAQVLRSRATNALANVVRHEATSSRTAAKPAATSKEFRERQVRFNIKNEQTEGRPLY 65

  Fly    66 LDAQATTPMDPRVLDAMLPYLTNFYGN 92
            |||||||||||||||||||||||||||
  Fly    66 LDAQATTPMDPRVLDAMLPYLTNFYGN 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
QtzlNP_001260401.1 AAT_I 64..>92 CDD:302748 27/27 (100%)
Nfs1NP_609533.1 AAT_I 63..462 CDD:388495 30/30 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S182
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D287160at33208
OrthoFinder 1 1.000 - - FOG0003620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.