DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Qtzl and Nfs1

DIOPT Version :10

Sequence 1:NP_723706.1 Gene:Qtzl / 318990 FlyBaseID:FBgn0051864 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_035041.2 Gene:Nfs1 / 18041 MGIID:1316706 Length:459 Species:Mus musculus


Alignment Length:31 Identity:26/31 - (83%)
Similarity:29/31 - (93%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RPLYLDAQATTPMDPRVLDAMLPYLTNFYGN 92
            ||||:|.|||||:||||||||||||.|:|||
Mouse    59 RPLYMDVQATTPLDPRVLDAMLPYLVNYYGN 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
QtzlNP_723706.1 NifS 62..>92 CDD:440721 24/29 (83%)
Nfs1NP_035041.2 PRK14012 60..459 CDD:184450 25/30 (83%)

Return to query results.
Submit another query.