powered by:
Protein Alignment Qtzl and nfs-1
DIOPT Version :9
Sequence 1: | NP_001260401.1 |
Gene: | Qtzl / 318990 |
FlyBaseID: | FBgn0051864 |
Length: | 123 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_492812.2 |
Gene: | nfs-1 / 172979 |
WormBaseID: | WBGene00015021 |
Length: | 412 |
Species: | Caenorhabditis elegans |
Alignment Length: | 38 |
Identity: | 24/38 - (63%) |
Similarity: | 29/38 - (76%) |
Gaps: | 0/38 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 KNEQTEGRPLYLDAQATTPMDPRVLDAMLPYLTNFYGN 92
|.|....:|:|||.|||.||||||:||||||:.|.:||
Worm 4 KIEPGSPQPIYLDVQATAPMDPRVVDAMLPYMINDFGN 41
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Qtzl | NP_001260401.1 |
AAT_I |
64..>92 |
CDD:302748 |
19/27 (70%) |
nfs-1 | NP_492812.2 |
AAT_I |
12..412 |
CDD:388495 |
22/30 (73%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S182 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D287160at33208 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003620 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.960 |
|
Return to query results.
Submit another query.