DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPCAT and YDR018C

DIOPT Version :9

Sequence 1:NP_001036265.1 Gene:LPCAT / 31899 FlyBaseID:FBgn0052699 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_010301.1 Gene:YDR018C / 851581 SGDID:S000002425 Length:396 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:29/136 - (21%)
Similarity:52/136 - (38%) Gaps:28/136 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LVVAPHSSYVD-------SILVVASGPPSIVAKRETADIPLLGKIINYAQPIYVQR---EDPNSR 207
            :::|.|..|.|       |.:....|...|:.|:....|||||..:...:.|::.|   :|..:.
Yeast   112 IIIANHQMYADWIYLWWLSFVSNLGGNVYIILKKALQYIPLLGFGMRNFKFIFLSRNWQKDEKAL 176

  Fly   208 QNTIRDIVDRARSTDDWP----------------QVVIFAEGTCTNRTALIKFKPGAFYPGVPVQ 256
            .|::..:...||......                .:::|.||  ||.:...:.|..||.....:.
Yeast   177 TNSLVSMDLNARCKGPLTNYKSCYSKTNESIAAYNLIMFPEG--TNLSLKTREKSEAFCQRAHLD 239

  Fly   257 PVLLKY 262
            .|.|::
Yeast   240 HVQLRH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPCATNP_001036265.1 PlsC 87..>265 CDD:223282 29/136 (21%)
LPLAT_LPCAT1-like 126..338 CDD:153253 29/136 (21%)
EF-hand_8 455..507 CDD:290545
YDR018CNP_010301.1 LPLAT_LCLAT1-like 102..308 CDD:153252 29/136 (21%)
Acyltransf_C 300..>347 CDD:406475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.