DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPCAT and SLC1

DIOPT Version :9

Sequence 1:NP_001036265.1 Gene:LPCAT / 31899 FlyBaseID:FBgn0052699 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_010231.1 Gene:SLC1 / 851508 SGDID:S000002210 Length:303 Species:Saccharomyces cerevisiae


Alignment Length:287 Identity:64/287 - (22%)
Similarity:116/287 - (40%) Gaps:80/287 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IYVLTVLLLPIRVVGCVLSLISAWMFACIGLYGMTLDDLKAKPLTGWRKQMQYMTA-CGMRMVYT 131
            :|.|..:|:.:.:.||             |.||:....|..  |.|.:...|::|| |       
Yeast     8 LYYLRSVLVVLALAGC-------------GFYGVIASILCT--LIGKQHLAQWITARC------- 50

  Fly   132 FGSFHYVTMK----------GRAATAKEAPILVVAPHSSYVDSILVVASGPP--SIVAKRETADI 184
               |::| ||          |....||: |.:::|.|.|.:|..::....||  ::.||:....:
Yeast    51 ---FYHV-MKLMLGLDVKVVGEENLAKK-PYIMIANHQSTLDIFMLGRIFPPGCTVTAKKSLKYV 110

  Fly   185 PLLGKIINYAQPIYVQREDPNSRQNTIRDIVDRARSTDD--WPQVVIFAEGT--CTNRTALIKFK 245
            |.||..:..:...::.|.......:|:...::..:....  |    :|.|||  .|:...::.||
Yeast   111 PFLGWFMALSGTYFLDRSKRQEAIDTLNKGLENVKKNKRALW----VFPEGTRSYTSELTMLPFK 171

  Fly   246 PGAFYPG----VPVQPVLLKYPN-----KYDTFTWTWDGPGVLRLLWLTMTQFYNRCEIEYLPVY 301
            .|||:..    :|:.||::...:     ||..|.   .|..::|:|               .|:.
Yeast   172 KGAFHLAQQGKIPIVPVVVSNTSTLVSPKYGVFN---RGCMIVRIL---------------KPIS 218

  Fly   302 TP--SEDEVADANLYANNVREVMAKAL 326
            |.  ::|::.:   :|..||:.|...|
Yeast   219 TENLTKDKIGE---FAEKVRDQMVDTL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPCATNP_001036265.1 PlsC 87..>265 CDD:223282 45/203 (22%)
LPLAT_LPCAT1-like 126..338 CDD:153253 49/228 (21%)
EF-hand_8 455..507 CDD:290545
SLC1NP_010231.1 AGP_acyltrn 60..191 CDD:129621 31/135 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.