DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPCAT and GPAT3

DIOPT Version :9

Sequence 1:NP_001036265.1 Gene:LPCAT / 31899 FlyBaseID:FBgn0052699 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_016864269.1 Gene:GPAT3 / 84803 HGNCID:28157 Length:526 Species:Homo sapiens


Alignment Length:314 Identity:76/314 - (24%)
Similarity:138/314 - (43%) Gaps:47/314 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VAASLTKRDSEED--TW-----ASKGYNYINPFVHRIEIDSHIEVAKIYVLTVL-----LLPIRV 80
            |...:|:|.|.|:  :|     .:..:.||:           :.:..::||.|:     |||:||
Human   200 VEDEVTQRFSSEELVSWNLLTRTNVNFQYIS-----------LRLTMVWVLGVIVRYCVLLPLRV 253

  Fly    81 VGCVLSLISAWMFACIGL----YGMTL-DDLKAKPLTGWRKQMQYMTACGMRMVYTFGSFHYVTM 140
            .           .|.||:    .|.|| ..|....|..|..::.::|.|.:.:....|:.||...
Human   254 T-----------LAFIGISLLVIGTTLVGQLPDSSLKNWLSELVHLTCCRICVRALSGTIHYHNK 307

  Fly   141 KGRAATAKEAPILVVAPHSSYVDSILVVASGPPSIVAKRETADIPLLGKIINYAQP-IYVQREDP 204
            :.|.....    :.||.|:|.:|.:::...|..::|.:.....:.::.:.:..|.| ::.:|.:.
Human   308 QYRPQKGG----ICVANHTSPIDVLILTTDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEM 368

  Fly   205 NSRQNTIRDIVDRARSTDDWPQVVIFAEGTCTNRTALIKFKPGAFYPGVPVQPVLLKYPNKYDTF 269
            ..|....:.:.:........| ::||.||||.|.|:::.||.|:|..|..:.||.:||..::...
Human   369 KDRHLVTKRLKEHIADKKKLP-ILIFPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDA 432

  Fly   270 TWTWDGPGVLRLLWLTMTQFYNRCEIEYLPVYTPSEDEVADANLYANNVREVMA 323
            .|......::..|...||.:...|::.|:|..|..|.|  ||..:||.|:..:|
Human   433 FWNSSKYNMVSYLLRMMTSWAIVCDVWYMPPMTREEGE--DAVQFANRVKSAIA 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPCATNP_001036265.1 PlsC 87..>265 CDD:223282 44/183 (24%)
LPLAT_LPCAT1-like 126..338 CDD:153253 49/199 (25%)
EF-hand_8 455..507 CDD:290545
GPAT3XP_016864269.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.