DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPCAT and AGPAT4

DIOPT Version :9

Sequence 1:NP_001036265.1 Gene:LPCAT / 31899 FlyBaseID:FBgn0052699 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_064518.1 Gene:AGPAT4 / 56895 HGNCID:20885 Length:378 Species:Homo sapiens


Alignment Length:195 Identity:43/195 - (22%)
Similarity:76/195 - (38%) Gaps:57/195 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IDSHIEVAKIYVLTVLLLPI-----RVVGCVLS-LISAWMFACIGLYGMTLDDLKAKPLTGWRKQ 117
            |.|.:.:..|.:.|:||.||     |.:.|.|| .||:.:...:..:..|...:...|    |..
Human    22 IASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDP----RAY 82

  Fly   118 MQYMTACGMRMVYTFGSFHYVTMKGRAATAKEAPILVVAPHSSYVDSI----------LVVASGP 172
            ::|                          .||..| ||..|...:|.:          |:   |.
Human    83 LKY--------------------------GKENAI-VVLNHKFEIDFLCGWSLSERFGLL---GG 117

  Fly   173 PSIVAKRETADIPLLGKIINYAQPIYVQREDPNSRQNTIRDIVDRARSTDDWPQ---VVIFAEGT 234
            ..::||:|.|.:|::|.:..:.:.::..|:....|: |:...:...|   |:|:   .:|..|||
Human   118 SKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRK-TVATSLQHLR---DYPEKYFFLIHCEGT 178

  Fly   235  234
            Human   179  178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPCATNP_001036265.1 PlsC 87..>265 CDD:223282 31/161 (19%)
LPLAT_LPCAT1-like 126..338 CDD:153253 25/122 (20%)
EF-hand_8 455..507 CDD:290545
AGPAT4NP_064518.1 PLN02380 20..345 CDD:178006 43/195 (22%)
LPLAT_LCLAT1-like 62..256 CDD:153252 29/155 (19%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 96..101 1/4 (25%)
Acyltransf_C 243..314 CDD:292694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.