Sequence 1: | NP_001036265.1 | Gene: | LPCAT / 31899 | FlyBaseID: | FBgn0052699 | Length: | 533 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011527964.1 | Gene: | AGPAT3 / 56894 | HGNCID: | 326 | Length: | 463 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 41/207 - (19%) |
---|---|---|---|
Similarity: | 82/207 - (39%) | Gaps: | 44/207 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 VLSLISAWMFACIGLYGMTLDDLKAKPLTGWRKQMQYMTACGMRMVYTFGSFHYVTMKGRAAT-- 146
Fly 147 ------------AKEAPILVVAPHSSYVD-----------SILVVASGPPSIVAKRETADIPLLG 188
Fly 189 KIINYAQPIYVQREDPNSRQNTIRDIVDRARSTDDWPQ---VVIFAEGTCTNRTALIKFKPGAFY 250
Fly 251 PGVPVQPVLLKY 262 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
LPCAT | NP_001036265.1 | PlsC | 87..>265 | CDD:223282 | 39/204 (19%) |
LPLAT_LPCAT1-like | 126..338 | CDD:153253 | 33/165 (20%) | ||
EF-hand_8 | 455..507 | CDD:290545 | |||
AGPAT3 | XP_011527964.1 | PLN02380 | 104..412 | CDD:178006 | 38/202 (19%) |
LPLAT_LCLAT1-like | 149..343 | CDD:153252 | 30/154 (19%) | ||
Acyltransf_C | 330..401 | CDD:292694 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0204 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |