DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPCAT and AGPAT3

DIOPT Version :9

Sequence 1:NP_001036265.1 Gene:LPCAT / 31899 FlyBaseID:FBgn0052699 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_011527964.1 Gene:AGPAT3 / 56894 HGNCID:326 Length:463 Species:Homo sapiens


Alignment Length:207 Identity:41/207 - (19%)
Similarity:82/207 - (39%) Gaps:44/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VLSLISAWMFACIGLYGMTLDDLKAKPLTGWRKQMQYMTACGMRMVYTFGSFHYVTMKGRAAT-- 146
            ||.|:..::|.   :.|:.::.::...|..|....|.......|:.|:..|...:.::..:.|  
Human    99 VLHLLVGFVFV---VSGLVINFVQLCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTEC 160

  Fly   147 ------------AKEAPILVVAPHSSYVD-----------SILVVASGPPSIVAKRETADIPLLG 188
                        .||..:::: .|:..:|           .:|    |...::||:|...:||:|
Human   161 TLFTDQATVERFGKEHAVIIL-NHNFEIDFLCGWTMCERFGVL----GSSKVLAKKELLYVPLIG 220

  Fly   189 KIINYAQPIYVQREDPNSRQNTIRDIVDRARSTDDWPQ---VVIFAEGTCTNRTALIKFKPGAFY 250
            ....:.:.::.:|:....|..    :|:..|...|:|:   .:::.|||....|........|..
Human   221 WTWYFLEIVFCKRKWEEDRDT----VVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAA 281

  Fly   251 PGVPVQPVLLKY 262
            .|:||    |||
Human   282 KGLPV----LKY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPCATNP_001036265.1 PlsC 87..>265 CDD:223282 39/204 (19%)
LPLAT_LPCAT1-like 126..338 CDD:153253 33/165 (20%)
EF-hand_8 455..507 CDD:290545
AGPAT3XP_011527964.1 PLN02380 104..412 CDD:178006 38/202 (19%)
LPLAT_LCLAT1-like 149..343 CDD:153252 30/154 (19%)
Acyltransf_C 330..401 CDD:292694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.