DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPCAT and Agpat1

DIOPT Version :9

Sequence 1:NP_001036265.1 Gene:LPCAT / 31899 FlyBaseID:FBgn0052699 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_006256034.1 Gene:Agpat1 / 406165 RGDID:1303287 Length:322 Species:Rattus norvegicus


Alignment Length:219 Identity:50/219 - (22%)
Similarity:87/219 - (39%) Gaps:36/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KQMQYMTACGMRMVYTFGSFHYVTMKGRAATAKEAPILVVAPHSSYVDSILVVASGPPSIV--AK 178
            :.|:.:....:.:.|.:|.  .|.::|........|.:||:.|.|.:|.:.::...|...|  ||
  Rat    99 ENMKILRLLLLHVKYLYGI--RVEVRGAQHFPPTQPYVVVSNHQSSLDLLGMMEVLPDRCVPIAK 161

  Fly   179 RETADIPLLGKIINYAQPIYVQREDPNSRQNTIRDIVDRARSTDDWPQVVIFAEGTCTNRTALIK 243
            ||.......|.....|..|::.|:......:.:.::.....:.|  .:|.:|.|||..:..:::.
  Rat   162 RELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQD--VRVWVFPEGTRNHNGSMLP 224

  Fly   244 FKPGAFY----PGVPVQPVLLK-----YPNKYDTFTWTWDGPGVLRLLWLTMTQFYNRCEIEYLP 299
            ||.|||:    ..||:.|:::.     |..|...||                   ..||::..||
  Rat   225 FKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFT-------------------SGRCQVRVLP 270

  Fly   300 VYTPSEDEVA-DANLYANNVREVM 322
            . .|:|.... |....|:.||..|
  Rat   271 P-VPTEGLTPDDVPALADRVRHSM 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPCATNP_001036265.1 PlsC 87..>265 CDD:223282 36/159 (23%)
LPLAT_LPCAT1-like 126..338 CDD:153253 49/209 (23%)
EF-hand_8 455..507 CDD:290545
Agpat1XP_006256034.1 LPLAT_AGPAT-like 104..290 CDD:153251 46/209 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.