DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPCAT and Agpat3

DIOPT Version :9

Sequence 1:NP_001036265.1 Gene:LPCAT / 31899 FlyBaseID:FBgn0052699 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001246793.1 Gene:Agpat3 / 39820 FlyBaseID:FBgn0036623 Length:397 Species:Drosophila melanogaster


Alignment Length:55 Identity:14/55 - (25%)
Similarity:26/55 - (47%) Gaps:3/55 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 LKSFLLCSLFCKLKNSDLLTFLRALIHLYSESSQQIDRESFVRLMRHAGGKLNEQ 478
            |:...||.......:...:.|::.|:|::   .:.||:..|.:||.:|...|..|
  Fly    21 LRLIHLCIALTFFTSGLCINFIQLLMHVF---IKPIDKRLFRKLMYYACYSLYSQ 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPCATNP_001036265.1 PlsC 87..>265 CDD:223282
LPLAT_LPCAT1-like 126..338 CDD:153253
EF-hand_8 455..507 CDD:290545 8/24 (33%)
Agpat3NP_001246793.1 PLN02380 23..387 CDD:178006 13/53 (25%)
LPLAT_LCLAT1-like 75..271 CDD:153252
Acyltransf_C 258..336 CDD:292694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.