powered by:
Protein Alignment LPCAT and Agpat3
DIOPT Version :9
Sequence 1: | NP_001036265.1 |
Gene: | LPCAT / 31899 |
FlyBaseID: | FBgn0052699 |
Length: | 533 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001246793.1 |
Gene: | Agpat3 / 39820 |
FlyBaseID: | FBgn0036623 |
Length: | 397 |
Species: | Drosophila melanogaster |
Alignment Length: | 55 |
Identity: | 14/55 - (25%) |
Similarity: | 26/55 - (47%) |
Gaps: | 3/55 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 424 LKSFLLCSLFCKLKNSDLLTFLRALIHLYSESSQQIDRESFVRLMRHAGGKLNEQ 478
|:...||.......:...:.|::.|:|:: .:.||:..|.:||.:|...|..|
Fly 21 LRLIHLCIALTFFTSGLCINFIQLLMHVF---IKPIDKRLFRKLMYYACYSLYSQ 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0204 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.