DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPCAT and CG15450

DIOPT Version :9

Sequence 1:NP_001036265.1 Gene:LPCAT / 31899 FlyBaseID:FBgn0052699 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster


Alignment Length:264 Identity:64/264 - (24%)
Similarity:116/264 - (43%) Gaps:41/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LLLPIRVVGCVLSL------------ISAWMFACIGLYGMTLDDLKAKPLTGWRKQMQYMTACGM 126
            ||||.|.:||.|.|            |..|.|             |.|.:....:|...:||..:
  Fly   147 LLLPFRTIGCWLCLFMISGVSMLLGHIPDWCF-------------KKKLVELVLRQCFRITAACL 198

  Fly   127 RMVYTFGSFHYVTMKGRAATAKEAPILVVAPHSSYVDSILVVASGPPSIVAKRETADIPLLGKII 191
            .|:..|.:..|...||          :.|..|:|.:|.::::.....|:..:..|..:.:|.:.:
  Fly   199 PMIRRFHNTEYRPTKG----------ICVCNHTSPLDVLVLMCDANYSLTGQVHTGILGVLQRAL 253

  Fly   192 N-YAQPIYVQREDPNSRQNTIRDIVDRAR-STDDWPQVVIFAEGTCTNRTALIKFKPGAFYPGVP 254
            : .:..::..|::...|:  ...:|.|.. |..|.|.|::|.||||.|.||:::||.|:|.....
  Fly   254 SRVSHHMWFDRKELADRE--ALGLVLRLHCSMKDRPPVLLFPEGTCINNTAVMQFKKGSFAVSDV 316

  Fly   255 VQPVLLKYPNKYDTFTWTWDGPGVLRLLWLTMTQFYNRCEIEYLPVYTPSEDEVADANLYANNVR 319
            |.||.::|..::....|......:||.:.:.::.:...|::.|:|..:...||  ....::|.|:
  Fly   317 VHPVAIRYDRRFGEAYWDSTRYSMLRYMLMVVSSWCICCDVWYMPALSRCNDE--SPVEFSNRVK 379

  Fly   320 EVMA 323
            ..:|
  Fly   380 AAIA 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPCATNP_001036265.1 PlsC 87..>265 CDD:223282 45/191 (24%)
LPLAT_LPCAT1-like 126..338 CDD:153253 47/200 (24%)
EF-hand_8 455..507 CDD:290545
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 49/207 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471356
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23063
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.