DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPCAT and Agpat1

DIOPT Version :9

Sequence 1:NP_001036265.1 Gene:LPCAT / 31899 FlyBaseID:FBgn0052699 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster


Alignment Length:347 Identity:72/347 - (20%)
Similarity:130/347 - (37%) Gaps:104/347 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IEIDSHIEVAKIYVLTVLLLPIRVVGCVLSLISAWMFACIGLYG-MTLDDLKAKPLTGWRKQMQY 120
            |.:.|.||:..:::|  |:||...   ..:.|..:.|..:..|| ::.:.:...|        .:
  Fly     2 ITMTSFIELLGLFLL--LMLPFLY---ETNHIFRYYFKFLMYYGIVSFNSIILIP--------AF 53

  Fly   121 MT-ACGMR-MVYTFGSFHYVT--------MKGRAATAKEAPILVVAPHSSYVDSI----LVVASG 171
            :| .|.:| :::.....|.|:        ::|:...||:...::||.|.|.:|.:    :.....
  Fly    54 LTRPCDVRNLLWASTWCHRVSTLIGLRWELRGKEHLAKDQACIIVANHQSSLDVLGMFNIWHVMN 118

  Fly   172 PPSIVAKRETADIPLLGKIINYAQP----------IYVQREDPNSRQNTIRDIVDRARS--TDDW 224
            ..::|||||          :.||.|          |::.|......:.|:.|:..|.:.  ...|
  Fly   119 KCTVVAKRE----------LFYAWPFGLAAWLAGLIFIDRVRGEKARETLNDVNRRIKKQRIKLW 173

  Fly   225 PQVVIFAEGTCTNRTALIKFKPGAFYPG----VPVQPVLLKYPNKYDTFTWTWDGPGVLRLLWLT 285
                :|.|||..|..||..||.|||:..    :|:.||:.   :.|.||                
  Fly   174 ----VFPEGTRRNTGALHPFKKGAFHMAIDQQIPILPVVF---SSYCTF---------------- 215

  Fly   286 MTQFYNRCEIEYLPVYTPSEDEVADANLYANNVREVMAKALGVPTSDYSFEDV-IVMSRARDMKI 349
                                  :.|.....|:.|.|:.....|.|...:.:|: ::|.|.|...|
  Fly   216 ----------------------LNDKKKILNSGRIVITTLPPVSTEGLTKDDIDVLMERVRSQMI 258

  Fly   350 P----FPGDIVEIERTIEKLGL 367
            .    ...:.:...:.|:|:|:
  Fly   259 ETFKVTSAEALHRYKPIKKVGI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPCATNP_001036265.1 PlsC 87..>265 CDD:223282 47/208 (23%)
LPLAT_LPCAT1-like 126..338 CDD:153253 49/240 (20%)
EF-hand_8 455..507 CDD:290545
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 51/238 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.