DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPCAT and Agpat2

DIOPT Version :9

Sequence 1:NP_001036265.1 Gene:LPCAT / 31899 FlyBaseID:FBgn0052699 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001101291.1 Gene:Agpat2 / 311821 RGDID:1309229 Length:278 Species:Rattus norvegicus


Alignment Length:327 Identity:71/327 - (21%)
Similarity:127/327 - (38%) Gaps:85/327 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LTVLLLPIRV---------VG--CV--LSLISAWMFACIGLY-GMTLDDLKAKPLTGWRKQMQYM 121
            |.:|||.:::         ||  ||  ||..:|....|:..: |.|:|::.   :..|..:    
  Rat    11 LLLLLLLVQLNRTARFYVKVGLYCVLCLSFSAAASIVCLLRHGGRTVDNMS---IISWFVR---- 68

  Fly   122 TACGMRMVYTFGSFHYV-----TMKGRAATAKEAPILVVAPHSSYVDSILVVASGPPSIV--AKR 179
                        ||.||     .:.|:.....:.|.::::.|.|.:|.:.::...|...|  |||
  Rat    69 ------------SFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPKRCVQIAKR 121

  Fly   180 ETADIPLLGKIINYAQPIYVQREDPNSRQNTIRDIVDRARSTDDWPQVVIFAEGTCTNRTALIKF 244
            |......:|.|:......::.|:...:..:.:.|:.|  ....:..:|.|:.|||..:...|:.|
  Rat   122 ELMFTGPVGLIMYLGGVYFINRQQAKTAMSLMADLGD--LMVKENLKVWIYPEGTRNDNGDLLPF 184

  Fly   245 KPGAFYPGVPVQ-PVLLKYPNKYDTFTWTWDGPGVLRLLWLTMTQFYNRCEIEYLPVYTPSEDEV 308
            |.||||..:..| |::   |..|.:|                 :.|||                 
  Rat   185 KKGAFYLAIQAQVPII---PVVYSSF-----------------SSFYN----------------- 212

  Fly   309 ADANLYANNVREVMAKALGVPTSDYSFEDV--IVMSRARDMKIPF--PGDIVEIERTIEKLGLNE 369
            ....|:.:....|.... .|||:..:..||  :|.:..:.|:..|  ..:|.:...||::.|:..
  Rat   213 VKTKLFTSGTIRVQVLD-AVPTNGLTDADVTKLVDTCYQSMRATFLQISEIPQENSTIKESGVLP 276

  Fly   370 SQ 371
            :|
  Rat   277 AQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPCATNP_001036265.1 PlsC 87..>265 CDD:223282 41/186 (22%)
LPLAT_LPCAT1-like 126..338 CDD:153253 45/219 (21%)
EF-hand_8 455..507 CDD:290545
Agpat2NP_001101291.1 LPLAT_AGPAT-like 67..240 CDD:153251 45/228 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.