DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPCAT and Agpat3

DIOPT Version :9

Sequence 1:NP_001036265.1 Gene:LPCAT / 31899 FlyBaseID:FBgn0052699 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001099848.1 Gene:Agpat3 / 294324 RGDID:1305787 Length:376 Species:Rattus norvegicus


Alignment Length:201 Identity:36/201 - (17%)
Similarity:78/201 - (38%) Gaps:64/201 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 HIEVAKIYVLTVLLLPIRVVGCVLSL--ISAWMFA---CIGLYGMTLDDLKAKPLTGWRKQMQYM 121
            |:.:..::|::.|::....: |.|:|  ||..::.   |...|.:            |.:.:..:
  Rat    14 HLLIGFVFVVSGLIINFTQL-CTLALWPISKNLYRRINCRLAYSL------------WSQLVMLL 65

  Fly   122 -----TACGM----RMVYTFGSFHYVTMKGRAATAKEAPILVVAPHSSYVD-----------SIL 166
                 |.|.:    ..|..||..|               ::|:..|:..:|           .:|
  Rat    66 EWWSCTECTLFTDQATVNHFGKEH---------------VVVILNHNFEIDFLCGWTMCERFGVL 115

  Fly   167 VVASGPPSIVAKRETADIPLLGKIINYAQPIYVQREDPNSRQNTIRDIVDRARSTDDWPQ---VV 228
                |...::||||...:||:|....:.:.::.:|:....|..    :::..|...::|:   .:
  Rat   116 ----GSSKVLAKRELLYVPLIGWTWYFLEIVFCKRKWEEDRDT----VIEGLRRLANYPEYMWFL 172

  Fly   229 IFAEGT 234
            ::.|||
  Rat   173 LYCEGT 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPCATNP_001036265.1 PlsC 87..>265 CDD:223282 31/176 (18%)
LPLAT_LPCAT1-like 126..338 CDD:153253 23/127 (18%)
EF-hand_8 455..507 CDD:290545
Agpat3NP_001099848.1 PLN02380 12..325 CDD:178006 36/201 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.