Sequence 1: | NP_001036265.1 | Gene: | LPCAT / 31899 | FlyBaseID: | FBgn0052699 | Length: | 533 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001099848.1 | Gene: | Agpat3 / 294324 | RGDID: | 1305787 | Length: | 376 | Species: | Rattus norvegicus |
Alignment Length: | 201 | Identity: | 36/201 - (17%) |
---|---|---|---|
Similarity: | 78/201 - (38%) | Gaps: | 64/201 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 HIEVAKIYVLTVLLLPIRVVGCVLSL--ISAWMFA---CIGLYGMTLDDLKAKPLTGWRKQMQYM 121
Fly 122 -----TACGM----RMVYTFGSFHYVTMKGRAATAKEAPILVVAPHSSYVD-----------SIL 166
Fly 167 VVASGPPSIVAKRETADIPLLGKIINYAQPIYVQREDPNSRQNTIRDIVDRARSTDDWPQ---VV 228
Fly 229 IFAEGT 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
LPCAT | NP_001036265.1 | PlsC | 87..>265 | CDD:223282 | 31/176 (18%) |
LPLAT_LPCAT1-like | 126..338 | CDD:153253 | 23/127 (18%) | ||
EF-hand_8 | 455..507 | CDD:290545 | |||
Agpat3 | NP_001099848.1 | PLN02380 | 12..325 | CDD:178006 | 36/201 (18%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0204 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |