DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPCAT and Lclat1

DIOPT Version :9

Sequence 1:NP_001036265.1 Gene:LPCAT / 31899 FlyBaseID:FBgn0052699 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_036016461.1 Gene:Lclat1 / 225010 MGIID:2684937 Length:492 Species:Mus musculus


Alignment Length:422 Identity:85/422 - (20%)
Similarity:139/422 - (32%) Gaps:125/422 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 TACGMRMVYTFGSFHYVTMKGRAATAKEAPILVVAPHSSYVD-----------SILVVASGPPSI 175
            |..|:|:|.|..:|    :.|..:       :::..|.:.||           |.|.|    ..|
Mouse   176 TMFGVRVVITGDAF----VPGERS-------VIIMNHRTRVDWMFLWNCLMRYSYLRV----EKI 225

  Fly   176 VAKRETADIPLLGKIINYAQPIYVQREDPNSRQNTIRDIVDRARSTDDWPQVVIFAEGTCTNRTA 240
            ..|.....:|..|..:..|..|::.|:..:.:.: ..|::|...:..:..|::||.|||......
Mouse   226 CLKSSLKSVPGFGWAMQVAAFIFIHRKWKDDKSH-FEDMIDYFCAIHEPLQLLIFPEGTDLTENN 289

  Fly   241 LIKFKPGAFYPGVPVQPVLLKYPNKYDTFTWTWD----GPGVLRLLWLTMTQFYN--RCEIEYLP 299
            ..:....|...|:.....:| :| :...||:..|    |..:..:..:|:...||  :.|...|.
Mouse   290 KARSNDFAEKNGLQKYEYVL-HP-RTTGFTFVVDRLREGKNLDAVHDITVAYPYNIPQTEKHLLL 352

  Fly   300 VYTPSEDEVADANLYANNVREVMAKALGVPTSDYSFEDVIVMSRAR-DMKIPFPGDIVEIERTIE 363
            ...|.|...        :|:...|.:|  |||.   ||:.:....| :.|........:.|:...
Mouse   353 GDFPKEIHF--------HVQRYPADSL--PTSK---EDLQLWCHRRWEEKEERLRSFYQGEKNFH 404

  Fly   364 KLGLNESQRDAELCKGFLRLSNTDRLDIITFGELLQVDLKNTDLHKLFALLDHRRSGTVSLKSFL 428
            ..|    |.....||..||:.....|.|:.:.                                |
Mouse   405 FTG----QSTVPPCKSELRVLVVKLLSIVYWA--------------------------------L 433

  Fly   429 LCSLFCKLKNSDLLTFLRALIHLYSESSQQIDRESFVRLMRHAGGKLNEQKAQALFYALDTDNLG 493
            .||..|            .||:|||..     |..|:              ...:|:.|.....|
Mouse   434 FCSAMC------------LLIYLYSPV-----RWYFI--------------ISIVFFVLQERIFG 467

  Fly   494 YVSFDSFVELTEKQKSSYKFLYHKSEHIRRPK 525
            .:   ..:||     :.|:|| ||..|:...|
Mouse   468 GL---EIIEL-----ACYRFL-HKHPHLNSKK 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPCATNP_001036265.1 PlsC 87..>265 CDD:223282 32/153 (21%)
LPLAT_LPCAT1-like 126..338 CDD:153253 48/228 (21%)
EF-hand_8 455..507 CDD:290545 7/51 (14%)
Lclat1XP_036016461.1 LPLAT_LCLAT1-like 171..364 CDD:153252 43/213 (20%)
Acyltransf_C 349..422 CDD:406475 20/89 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.