DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment LPCAT and acl-8

DIOPT Version :9

Sequence 1:	NP_001036265.1	Gene:	LPCAT / 31899	FlyBaseID:	FBgn0052699	Length:	533	Species:	Drosophila melanogaster
Sequence 2:	NP_001348648.1	Gene:	acl-8 / 179031	WormBaseID:	WBGene00020264	Length:	372	Species:	Caenorhabditis elegans

Alignment Length:	142	Identity:	29/142 - (20%)
Similarity:	51/142 - (35%)	Gaps:	32/142 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly   114 WRKQMQYMTACGMRMV------------YTFGSFHYVTMKGRAATAKEAPILVVAPHSSYVDSIL 166
            ||       .|..|:|            :.||....||   .....::.|.:::..|.:.:|.:.
Worm    39 WR-------TCADRLVGFWLTFPCSLIEWVFGVNFRVT---GDLIERDEPAILIMNHRTRLDWLF 93

  Fly   167 ----VVASGP-----PSIVAKRETADIPLLGKIINYAQPIYVQREDPNSRQNTIRDIVDRARSTD 222
                :....|     ..|..|.....||..|..::....|::.|...|.:. .:..||.....::
Worm    94 SWNALYKMDPWLLTTEKISLKAPLKKIPGAGWAMSSGSYIFLDRNFENDKP-VLERIVKYYSGSE 157

  Fly   223 DWPQVVIFAEGT 234
            ...|:::|||||
Worm   158 KKYQILLFAEGT 169

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
LPCAT	NP_001036265.1	PlsC	87..>265	CDD:223282	29/142 (20%)
		LPLAT_LPCAT1-like	126..338	CDD:153253	26/130 (20%)
		EF-hand_8	455..507	CDD:290545
acl-8	NP_001348648.1	LPLAT_LCLAT1-like	55..250	CDD:153252	24/119 (20%)
acl-8	NP_001348648.1	Acyltransf_C	236..313	CDD:374349
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0204
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900