DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LPCAT and Agpat4

DIOPT Version :9

Sequence 1:NP_001036265.1 Gene:LPCAT / 31899 FlyBaseID:FBgn0052699 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_006227918.1 Gene:Agpat4 / 170919 RGDID:619916 Length:414 Species:Rattus norvegicus


Alignment Length:303 Identity:62/303 - (20%)
Similarity:103/303 - (33%) Gaps:111/303 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IDSHIEVAKIYVLTVLLLPI----------RVVGCVLS----LISAWMFACIGLYGMTLDDLKAK 109
            |.|.:.|..|.:.|:::.||          |:..||.|    |:..|......:|    .|.||.
  Rat    58 IASGLIVNAIQLCTLVIWPINKQLFRKINARLCYCVSSQLVMLLEWWSGTECTIY----TDPKAS 118

  Fly   110 PLTGWRKQMQYMTACGMRMVYTFGSFHYVTMKGRAATAKEAPILVVAPHSSYVD----------- 163
            |                         ||         .||..| ||..|...:|           
  Rat   119 P-------------------------HY---------GKENAI-VVLNHKFEIDFLCGWSLAERL 148

  Fly   164 SILVVASGPPSIVAKRETADIPLLGKIINYAQPIYVQREDPNSRQNTIRDIVDRARSTDDWPQVV 228
            .||    |...::||:|.|.:|::|.:..:.:.|:..|:....||...:.::    ...|:|:..
  Rat   149 GIL----GNSKVLAKKELAYVPIIGWMWYFVEMIFCTRKWEQDRQTVAKSLL----HLRDYPEKY 205

  Fly   229 IF---AEGT--------CTNRTALIKFKPGAFYPGVP--------------VQPVL----LKYPN 264
            :|   .|||        .:.:.|..|..|...:..:|              |.|.:    |.:.|
  Rat   206 LFLIHCEGTRFTEKKHQISMQVAQAKGLPSLKHHLLPRTKGFAITVKCLRDVVPAVYDCTLNFRN 270

  Fly   265 KYDTFTWTWDGPGVLRLLWLTMTQFYNRCEIEYLPVYTPSEDE 307
            .        :.|.:|.:  |...:::..|.:..:|:....|||
  Rat   271 N--------ENPTLLGV--LNGKKYHADCYVRRIPMEDIPEDE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LPCATNP_001036265.1 PlsC 87..>265 CDD:223282 42/217 (19%)
LPLAT_LPCAT1-like 126..338 CDD:153253 44/222 (20%)
EF-hand_8 455..507 CDD:290545
Agpat4XP_006227918.1 PlsC 51..325 CDD:223282 62/303 (20%)
LPLAT_LCLAT1-like 98..292 CDD:153252 47/250 (19%)
Acyltransf_C 279..350 CDD:292694 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.